PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000258046
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 469aa    MW: 52293.1 Da    PI: 7.7506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000258046genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+ Ed +++ +v ++G g+W++++++ g++R++k+c++rw +yl
    MDP0000258046 14 RGLWTAAEDAKILAYVSKYGVGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding46.68.1e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E++ +++++k  G++ W+ Ia+ ++ gRt++++k++w++
    MDP0000258046  68 DNFTPQEEQHIINLHKAIGSR-WSHIAKQLP-GRTDNDVKNYWNT 110
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.167965IPR017930Myb domain
SuperFamilySSF466891.1E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001672.51E-111761No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129417.53166116IPR017930Myb domain
SMARTSM007174.6E-1366114IPR001005SANT/Myb domain
CDDcd001678.01E-1069112No hitNo description
PfamPF002492.4E-1369110IPR001005SANT/Myb domain
PfamPF156971.2E-9373433IPR031421Protein of unknown function DUF4666
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTAA EDAKILAYVS KYGVGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TPQEEQHIIN LHKAIGSRWS HIAKQLPGRT DNDVKNYWNT KLKKKLSKMG  120
IDPVTHKPYS QILSDYGNIS GLPTAAGNQL SYFFKFSNRA FAPEPEPSSG ITGIPYTRVM  180
MNPNINGQGS EHNSCDSTLS LGFLAHRFQE SVQIEQPHFL NEVTSSCSSS SSPRATDHQL  240
ISQPTYACRE SHEAQVTPSS SPFNWSEFLL HDPFASADPF ASADHLKQEQ DLHDVVMSAL  300
ENPKLGVQGN SDAIEGCDFG GQRSNGLLDQ QASSSSMSSF VETILDQDIK EGDRXKTDET  360
KQDGDRDXKY RSMTALQRSA TSFRRQGSSG LIWEDKIQVL XKKPTLKVXI SMNKTDGEEH  420
PNXDEGFRER KDADSHSSPD SSLRSKPEEN VHKCSLCTVF GRCMRPPAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341741.10.0PREDICTED: transcription factor MYB29-like
TrEMBLM5XBU21e-162M5XBU2_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.18e-77MYB family protein